You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419317 |
---|---|
Category | Proteins |
Description | Recombinant Human Fibroblast growth factor 1 active |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 97% as determined by SDS-PAGE and HPLC. |
MW | 17.5 kDa |
UniProt ID | P05230 |
Protein Sequence | AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSS |
Protein Length | Full Length |
Source | E.Coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 106 IU/mg in the presence of 10 μg/ml of heparin. |
Expression Region | 1-155aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 2 mM EDTA, 0.5 mM DTT, 5 % Trehalose |
Alternative names | FGF-1, aFGF, Endothelial cell growth factor, ECGF, Read more... |
Note | For research use only |
Application notes | Tag Info: NO-taggedExpression Region: 1-155aaSequence Info: Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
IF, WB | |
Human | |
Mouse | |
Polyclonal | |
Unconjugated |
> 95% as determined by SDS-PAGE and HPLC. | |
16.0 kDa | |
E.Coli |
Greater than 90% as determined by SDS-PAGE. | |
31.8 kDa | |
E.coli |