Human Complement C3 Protein

SKU: orb1478159

Description

This Human Complement C3 Protein spans the amino acid sequence from region 26-225aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-tagged
• Expression Region: 26-225aa
• Protein Length: Partial
• MW: 26.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ASP, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1, C3, C3adesArg, C3bc, CO3_HUMAN, Complement C3c alpha'' chain fragment 2

Quick Database Links

UniProt

P01024