You have no items in your shopping cart.
Featured
Description
Research Area
Cell Biology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Baculovirus |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 32-240aa |
| Protein Length | Extracellular Domain |
| MW | 26.6 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ACHA3_HUMAN, AChR, Cholinergic receptor neuronal nicotinic alpha polypeptide 3, Cholinergic receptor nicotinic alpha 3, Cholinergic receptor nicotinic alpha polypeptide 3, CHRNA 3, CHRNA3, LNCR2, MGC104879, NACHRA 3, NACHRA3, Neuronal acetylcholine receptor protein alpha 3 chain precursor, Neuronal acetylcholine receptor subunit alpha 3, Neuronal acetylcholine receptor subunit alpha-3, Neuronal nicotinic acetylcholine receptor alpha 3 subunit, PAOD2
Similar Products
−- Item 1 of 1
Human CHRNA3 protein [orb54589]
Greater than 90% as determined by SDS-PAGE.
44.6 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 1
Human CHRNA3 protein [orb605307]
Greater than 85% as determined by SDS-PAGE.
26.0 kDa
Yeast
100 μg, 20 μg, 1 mg 
Recombinant Human CHRNA3 Protein, N-His [orb2968701]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
26.91 kDa
1 mg, 50 μg, 100 μgRecombinant Human CHRNA3 Protein, N-His [orb3152898]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
26.91 kDa
50 μg, 100 μg, 1 mgHuman Nicotinic Acetylcholine Receptor alpha 3 protein [orb754473]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
22.9 kDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-6 weeks