Human CHRNA3 protein

SKU: orb54589

Description

This Human CHRNA3 protein spans the amino acid sequence from region 32-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  N-terminal 6xHis-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged26-147AA: 32-240AAFull Length: Extracellular Domain

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• Molecular Weight: 44.6 kDa
• Expression Region: 32-240aa
• Protein Length: Extracellular Domain
• Protein Sequence: SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

ACHA3_HUMAN, AChR, Cholinergic receptor neuronal nicotinic alpha polypeptide 3, Cholinergic receptor nicotinic alpha 3, Cholinergic receptor nicotinic alpha polypeptide 3, CHRNA 3, CHRNA3, LNCR2, MGC104879, NACHRA 3, NACHRA3, Neuronal acetylcholine receptor protein alpha 3 chain precursor, Neuronal acetylcholine receptor subunit alpha 3, Neuronal acetylcholine receptor subunit alpha-3, Neuronal nicotinic acetylcholine receptor alpha 3 subunit, PAOD2

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P32297