You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal hFc1-tagged |
| Molecular Weight | 41.5 kDa |
| Expression Region | 19-139aa |
| Protein Length | Partial |
| Protein Sequence | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Integrin Associated Protein (IAP) ELISA Kit [orb777249]
Human
0.32-20 ng/mL
0.111 ng/mL
96 T, 48 THuman Integrin Associated Protein (IAP) ELISA Kit [orb1948686]
Human
0.16-10ng/mL
0.1 ng/mL
48 T, 96 TRecombinant Human CD47 Protein [orb2995144]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 90% as determined by SEC-HPLC.(QC verified)
Predicted: 14.76 KDa. Observed: 30-45 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human CD47 Protein (Biotin) [orb2993805]
Biotin
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 16.4 KDa. Observed: 30-40 KDa, reducing conditions
20 μg, 100 μgRecombinant Human CD47 Protein [orb2994047]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 40.3 KDa. Observed: 48-65 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SIRPA at 2 μg/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42 ng/ml.

Human SIRPA protein His/Myc tag captured on COOH chip can bind Human CD47 protein Fc tag with an affinity constant of 19.1 nM as detected by LSPR Assay.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human CD47 protein (orb705335)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

