HS3ST3B1 Rabbit Polyclonal Antibody

• Catalog Number: orb579843
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HS3ST3B1
• Target: HS3ST3B1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HS3ST3B1
• Protein Sequence: Synthetic peptide located within the following region: AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR
• UniProt ID: Q9Y662
• MW: 43kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: 3OST3B1, 3-OST-3B, h3-OST-3B
• Note: For research use only
• NCBI: NP_006032

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-HS3ST3B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.