Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HS3ST3B1 Rabbit Polyclonal Antibody

SKU: orb579843

Description

HS3ST3B1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of HS3ST3B1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human HS3ST3B1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HS3ST3B1
TargetHS3ST3B1
Protein SequenceSynthetic peptide located within the following region: AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR
Molecular Weight43kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

3OST3B1, 3-OST-3B, h3-OST-3B

Similar Products

  • HS3ST3B1 Rabbit Polyclonal Antibody [orb184118]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HS3ST3B1 Rabbit Polyclonal Antibody (FITC) [orb188431]

    ICC,  IF

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    FITC

    100 μl
  • HS3ST3B1 Rabbit Polyclonal Antibody (HRP) [orb477061]

    ELISA,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    HRP

    100 μl
  • HS3ST3B1 Rabbit Polyclonal Antibody (APC) [orb1002749]

    ICC,  IF

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    APC

    100 μl
  • HS3ST3B1 Rabbit Polyclonal Antibody (Cy5) [orb949886]

    ICC,  IF

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    Cy5

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HS3ST3B1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

HS3ST3B1 Rabbit Polyclonal Antibody

WB Suggested Anti-HS3ST3B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006032

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

HS3ST3B1 Rabbit Polyclonal Antibody (orb579843)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry