You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582470 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HINT1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HINT1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 14kDa |
Target | HINT1 |
UniProt ID | P49773 |
Protein Sequence | Synthetic peptide located within the following region: ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTH |
NCBI | NP_005331 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HINT, NMAN, PKCI-1, PRKCNH1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
HINT1 antibody - N-terminal region (orb582470), Catalog Number: orb582470, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasm of bronchial epithelial tissue, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Kidney
WB Suggested Anti-HINT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate. HINT1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |