HINT1 Rabbit Polyclonal Antibody

• Catalog Number: orb582471
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HINT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HINT1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 14kDa
• Target: HINT1
• UniProt ID: P49773
• Protein Sequence: Synthetic peptide located within the following region: CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD
• NCBI: NP_005331
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HINT, NMAN, PKCI-1, PRKCNH1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

HINT1 antibody - N-terminal region (orb582471), Catalog Number: orb582471, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasm of bronchial epithelial tissue, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. HINT1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Kidney

WB Suggested Anti-HINT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. HINT1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.