HGH1 Rabbit Polyclonal Antibody

• Catalog Number: orb55764
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HGH1.
• Target: HGH1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse HGH1
• Protein Sequence: Synthetic peptide located within the following region: LRNCCFEHRHHEWLLGPEVDILPFLLLPLAGPEDFSEEEMERLPVDLQYL
• UniProt ID: Q8C3I8
• MW: 43 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BRP16, BRP16L, FAM203A, FAM203B, C8orf30A, C8orf30
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_057542.2
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Intestine lysates, Antibody dilution: 1.0 ug/ml.