GRIA2 Rabbit Polyclonal Antibody

• Catalog Number: orb592804
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRIA2
• Target: GRIA2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2
• Protein Sequence: Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR
• UniProt ID: P42262
• MW: 99kDa
• Tested applications: IHC
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B
• Research Area: Signal Transduction
• Note: For research use only
• NCBI: NP_000817

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Type: Mouse Gut Tissue, Primary Dilution: 20 ug/ml and 4 ug/ml, Secondary (Goat Anti-Rabbit Cy3) Dilution: 1:1500.