You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb592804 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GRIA2 |
| Target | GRIA2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2 |
| Protein Sequence | Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR |
| UniProt ID | P42262 |
| MW | 99kDa |
| Tested applications | IHC |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B Read more... |
| Research Area | Signal Transduction |
| Note | For research use only |
| NCBI | NP_000817 |

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Type: Mouse Gut Tissue, Primary Dilution: 20 ug/ml and 4 ug/ml, Secondary (Goat Anti-Rabbit Cy3) Dilution: 1:1500.
FC, IF, IHC-Fr, IHC-P, WB | |
Canine, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Canine, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review