GRIA2 Rabbit Polyclonal Antibody

SKU: orb592804

Description

GRIA2 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of GRIA2. It is suitable for IHC application. The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2. This antibody reacts with Mouse samples and is predicted to react with Bovine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: IHC
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2
• Target: GRIA2
• Protein Sequence: Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR
• Molecular Weight: 99kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B, GluR-K2

Quick Database Links

Gene Symbol

GRIA2

UniProt

P42262

RefSeq (Protein):NP_000817