GRIA2 Rabbit Polyclonal Antibody

• Catalog Number: orb592789
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRIA2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 99kDa
• Target: GRIA2
• UniProt ID: P42262
• Protein Sequence: Synthetic peptide located within the following region: STSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTIT
• NCBI: NP_000817
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Application: Immunohistochemistry, Species+tissue/cell type: Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStop, How many ug'sof tissue/cell lysate run on the gel: 11 m Mouse Gut Tissue, Primary antibody dilution: 1:50, Secondary antibody: Goat anti-rabbit-cy3, Secondary antibody dilution: 1:1500.

WB Suggested Anti-GRIA2 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.