You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb576371 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GPC3 |
| Target | GPC3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GPC3 |
| Protein Sequence | Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL |
| UniProt ID | P51654 |
| MW | 66 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2 |
| Research Area | Signal Transduction |
| Note | For research use only |
| NCBI | NP_004475 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. GPC3 is shown in multiple isoforms and is also cleaved to a 36 kDa mature subunit.

Sample Tissue: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/ml.

Rabbit Anti-GPC3 antibody, Catalog Number: orb576371, Paraffin Embedded Tissue: Human Placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-GPC3 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review