GPC3 Rabbit Polyclonal Antibody

• Catalog Number: orb576371
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPC3
• Target: GPC3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPC3
• Protein Sequence: Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
• UniProt ID: P51654
• MW: 66 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2
• Research Area: Signal Transduction
• Note: For research use only
• NCBI: NP_004475

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. GPC3 is shown in multiple isoforms and is also cleaved to a 36 kDa mature subunit.

Sample Tissue: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/ml.

Rabbit Anti-GPC3 antibody, Catalog Number: orb576371, Paraffin Embedded Tissue: Human Placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-GPC3 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.