You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330253 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GNAS |
Target | GNAS |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS |
Protein Sequence | Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
UniProt ID | Q5FWY2 |
MW | 42kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti RP4-543J19.4 antibody, anti AHO antibody, ant Read more... |
Note | For research use only |
NCBI | NP_536351 |
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, GNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
Human kidney
Human Lung
Rabbit Anti-GNAS Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-GNAS antibody Titration: 1 ug/mL, Sample Type: Human Jurkat.
WB Suggested Anti-GNAS antibody Titration: 1 ug/mL, Sample Type: Human MCF7.
WB Suggested Anti-GNAS Antibody Titration: 1 ug/mL, Positive Control: HepG2 lysate. There is BioGPS gene expression data showing that GNAS is expressed in HepG2.
WB Suggested Anti-GNAS Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that GNAS is expressed in Jurkat.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Hamster, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |