GNAS Rabbit Polyclonal Antibody

• Catalog Number: orb330253
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GNAS
• Target: GNAS
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
• Protein Sequence: Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
• UniProt ID: Q5FWY2
• MW: 42kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti RP4-543J19.4 antibody, anti AHO antibody, ant
• Research Area: Epigenetics & Chromatin, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_536351

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, GNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

Human kidney

Human Lung

Rabbit Anti-GNAS Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-GNAS antibody Titration: 1 ug/mL, Sample Type: Human Jurkat.

WB Suggested Anti-GNAS antibody Titration: 1 ug/mL, Sample Type: Human MCF7.

WB Suggested Anti-GNAS Antibody Titration: 1 ug/mL, Positive Control: HepG2 lysate. There is BioGPS gene expression data showing that GNAS is expressed in HepG2.

WB Suggested Anti-GNAS Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that GNAS is expressed in Jurkat.