GNAS Rabbit Polyclonal Antibody

SKU: orb330201

Description

GNAS Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of GNAS. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
• Target: GNAS
• Protein Sequence: Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ
• Molecular Weight: 46kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AHO antibody, anti C20orf45 antibody, anti GNAS1 antibody, anti GPSA antibody, anti GSA antibody, anti GSP antibody, anti MGC33735 antibody, anti PHP1A antibody, anti PHP1B antibody, anti POH antibody, anti dJ309F20.1.1 antibody, anti dJ806M20.3.3 antibody, anti NESP antibody, anti PHP1C antibody

Quick Database Links

Gene Symbol

GNAS

UniProt

P63092

RefSeq (Protein):NP_000507