You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330201 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GNAS |
| Target | GNAS |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS |
| Protein Sequence | Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
| UniProt ID | P63092 |
| MW | 46kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti AHO antibody, anti C20orf45 antibody, anti GN Read more... |
| Research Area | Disease Biomarkers, Epigenetics & Chromatin, Immun Read more... |
| Note | For research use only |
| NCBI | NP_000507 |

Sample Type: Nthy-ori cell lysate (50 ug), Primary Dilution: 1:1000, Secondary Antibody: anti-rabbit HRP, Secondary Dilution: 1:2000.

WB Suggested Anti-GNAS antibody Titration: 1 ug/mL, Sample Type: Human MCF7.

WB Suggested Anti-GNAS Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that GNAS is expressed in Jurkat.
IHC, WB | |
Bovine, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review