GNAS Rabbit Polyclonal Antibody

• Catalog Number: orb330201
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GNAS
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: GNAS
• UniProt ID: P63092
• Protein Sequence: Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ
• NCBI: NP_000507
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AHO antibody, anti C20orf45 antibody, anti GN
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Nthy-ori cell lysate (50 ug), Primary Dilution: 1:1000, Secondary Antibody: anti-rabbit HRP, Secondary Dilution: 1:2000.

WB Suggested Anti-GNAS antibody Titration: 1 ug/mL, Sample Type: Human MCF7.

WB Suggested Anti-GNAS Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that GNAS is expressed in Jurkat.