You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330201 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GNAS |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 46kDa |
Target | GNAS |
UniProt ID | P63092 |
Protein Sequence | Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
NCBI | NP_000507 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AHO antibody, anti C20orf45 antibody, anti GN Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Jurkat cell lysate tissue using GNAS antibody
Western blot analysis of human thryoid tissue using GNAS antibody
Western blot analysis of human MCF7 tissue using GNAS antibody
IHC, WB | |
Bovine, Human, Mouse, Porcine, Rabbit, Rat | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating