GNAS Rabbit Polyclonal Antibody

• Catalog Number: orb330252
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GNAS
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46 kDa
• Target: GNAS
• UniProt ID: P63092
• Protein Sequence: Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
• NCBI: NP_000507
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AHO antibody, anti C20orf45 antibody, anti GN
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The canonical isoform of 46 kDa is present as well as a second isoform around 111 kDa.

Anti-GNAS antibody IHC staining of human thyroid. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL.

Sample Type: MCF7 Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.

Lane 1: INS1 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Donkey anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Gene Name: GNAS.

Rabbit Anti-GNAS Antibody, Paraffin Embedded Tissue: Human Pancreas, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-GNAS Antibody Titration: 1 ug/mL, Positive Control: MCF-7 Whole Cell, lysate, sGNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.