You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330252 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GNAS |
Target | GNAS |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS |
Protein Sequence | Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD |
UniProt ID | P63092 |
MW | 46 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti AHO antibody, anti C20orf45 antibody, anti GN Read more... |
Note | For research use only |
NCBI | NP_000507 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The canonical isoform of 46 kDa is present as well as a second isoform around 111 kDa.
Anti-GNAS antibody IHC staining of human thyroid. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL.
Sample Type: MCF7 Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.
Lane 1: INS1 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Donkey anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Gene Name: GNAS.
Rabbit Anti-GNAS Antibody, Paraffin Embedded Tissue: Human Pancreas, Antibody Concentration: 5 ug/mL.
WB Suggested Anti-GNAS Antibody Titration: 1 ug/mL, Positive Control: MCF-7 Whole Cell, lysate, sGNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
IHC, WB | |
Bovine, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Hamster, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
PLA, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |