Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GLP-1 (7-36), amide, chicken, common turkey

SKU: orb2942717

Description

This synthetic peptide is the amidated chicken and common turkey GLP-1 (7-36) fragment with the sequence HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2. It serves as a research tool for studying incretin hormone physiology, insulin secretion, and metabolic functions in avian and comparative in vitro and in vivo models.

Images & Validation

Key Properties

MW3327.61
FormulaC149H224N40O47
SMILES[H]N[C@@H](CC1=CN=CN1)C(N[C@@H](C)C(N[C@H](C(NCC(N[C@]([H])(C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@]([H])(C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@]([H])(C(N[C@]([H])(C(N[C@H](C(N[C@@H](CC3=CC=C(C=C3)O)C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@@H](C)C(N[C@@H](C)C(N[C@H](C(N[C@H](C(N[C@@H](CC4=CC=CC=C4)C(N[C@]([H])(C(N[C@@H](C)C(N[C@@H](CC5=CNC6=C5C=CC=C6)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N)=O)CCCNC(N)=N)=O)=O)CC(N)=O)=O)C(C)C)=O)CC(C)C)=O)=O)=O)[C@@H](C)CC)=O)=O)CCC(O)=O)=O)CCCCN)=O)=O)=O)CCC(N)=O)=O)=O)CCC(O)=O)=O)CC(C)C)=O)=O)CO)=O)[C@H](O)C)=O)[C@@H](C)CC)=O)=O)CO)=O)[C@H](O)C)=O)=O)[C@H](O)C)=O)=O)CCC(O)=O)=O)=O

Storage & Handling

Storage-20°C
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Key Properties

No computed properties available.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

GLP-1 (7-36), amide, chicken, common turkey (orb2942717)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet