GLP-1 (7-36) amide (chicken, common turkey)

• Catalog Number: orb2694385
• Category: Proteins
• Description: Glucagon-Like Peptide 1 (GLP-1) is synthesized by posttranslational processing of proglucagon in the intestine and pancreas and plays an important role in metabolic homeostasis. Among the different molecular forms, such as GLP-1 (7-36) amide and GLP-1 (7-37), the function of GLP-1 (1-37) has been unclear. GLP-1 (1-37) was shown to convert intestinal epithelial cells into insulin-producing cells. These observations turned GLP-1 (1-37) into a new promising therapeutic compound for the treatment of diabetes mellitus. In animal models of dilated cardiomyopathy, hypertensive heart failure, and myocardial infarction, GLP-1 has shown a remarkable cardioprotective activity.
• Target: others
• Purity: ≥95%
• Protein Sequence: HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2
• MW: 3327.69
• CAS Number: 1802078-26-7
• Formula: C₁₄₉H₂₂₄N₄₀O₄₇
• Note: For research use only