You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592834 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GLI1 |
Target | GLI1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GLI1 |
Protein Sequence | Synthetic peptide located within the following region: LRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLF |
UniProt ID | P08151 |
MW | 118kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | GLI, PPD1, PAPA8 |
Research Area | Cancer Biology, Cell Biology, Epigenetics & Chroma Read more... |
Note | For research use only |
NCBI | NP_005260 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-GLI1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Bovine, Canine, Equine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
BF555 |