Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

GLI1 Rabbit Polyclonal Antibody

SKU: orb574163

Description

GLI1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of GLI1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human GLI1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GLI1
TargetGLI1
Protein SequenceSynthetic peptide located within the following region: TNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEP
Molecular Weight118 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

GLI, PPD1, PAPA8

Similar Products

  • GLI1 Rabbit Polyclonal Antibody [orb10718]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-Gli1 (T101/ S102/S104) Rabbit Polyclonal Antibody [orb506139]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • GLI1 Rabbit Polyclonal Antibody (BF555) [orb1585214]

    FC,  IF

    Bovine, Canine, Equine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    BF555

    100 μl
  • GLI1 Antibody (N-Term) [orb1925940]

    WB

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • GLI1 Rabbit Polyclonal Antibody [orb1952725]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GLI1 Rabbit Polyclonal Antibody

WB Suggested Anti-GLI1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.

GLI1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 118 kDa isoform is identified, a second isoform of 114 kDa, and a third isoform of 105 kDa are also present in some samples.

GLI1 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.

GLI1 Rabbit Polyclonal Antibody

Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 0.5 ug/ml.

GLI1 Rabbit Polyclonal Antibody

Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 5.0 ug/ml.

GLI1 Rabbit Polyclonal Antibody

WB Suggested Anti-GLI1 Antibody Titration: 1.0 ug/ml, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005260

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

GLI1 Rabbit Polyclonal Antibody (orb574163)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry