GATA3 Rabbit Polyclonal Antibody

• Catalog Number: orb574261
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GATA3
• Target: GATA3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GATA3
• Protein Sequence: Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS
• UniProt ID: P23771
• MW: 48kDa
• Tested applications: IF, IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HDR, HDRS
• Note: For research use only
• NCBI: NP_002042

Rabbit Anti-GATA3 Antibody, Paraffin Embedded Tissue: Human Liver Cellular Data: Hepatocyte Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Sample Type: Human Embryonic Stem cell H1 differentiated to HNF4 positive hepatic progenitor cells, dilution: 1:250.

WB Suggested Anti-GATA3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that GATA3 is expressed in Jurkat.

WB Suggested Anti-GATA3 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that GATA3 is expressed in Jurkat.