GATA2 Rabbit Polyclonal Antibody

• Catalog Number: orb573929
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GATA2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GATA2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51 kDa
• Target: GATA2
• UniProt ID: P23769
• Protein Sequence: Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
• NCBI: NP_116027
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DCML, IMD21, NFE1B, MONOMAC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

Human Liver

Lane 1: 30 ug mouse liver lysate, Lane 2: 30 ug mouse N2a cell lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: GATA2.

WB Suggested Anti-GATA2 antibody Titration: 1 ug/ml, Sample Type: Human K562.

WB Suggested Anti-GATA2 Antibody Titration: 1.0-2.0 ug/ml, ELISA Titer: 1:1562500, Positive Control: K562 cell lysate, GATA2 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells.