You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329742 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOXP2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Canine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 80kDa |
Target | FOXP2 |
UniProt ID | O15409 |
Protein Sequence | Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA |
NCBI | NP_055306 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CAGH44 antibody, anti DKFZp686H1726 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human kidney tissue using FOXP2 antibody
Western blot analysis of human HepG2 tissue using FOXP2 antibody
Western blot analysis of HepG2 cell lysate tissue using FOXP2 antibody
ELISA, IHC | |
Bovine, Canine, Feline, Human, Mouse, Porcine, Rat, Zebrafish | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating