FOXP2 Rabbit Polyclonal Antibody

SKU: orb329741

Description

Rabbit polyclonal antibody to FOXP2

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP2
• Target: FOXP2
• Protein Sequence: Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
• Molecular Weight: 80kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti SPCH1 antibody, anti CAGH44 antibody, anti TNRC10 antibody

Rabbit Anti-FOXP2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2.

WB Suggested Anti-FOXP2 Antibody, Titration: 0.5 ug/mL, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

FOXP2

UniProt

O15409

RefSeq (Protein):NP_055306