You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576501 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOXO3 |
Target | FOXO3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXO3 |
Protein Sequence | Synthetic peptide located within the following region: MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGE |
UniProt ID | O43524 |
MW | 71kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FOXO2, AF6q21, FKHRL1, FOXO3A, FKHRL1P2 |
Note | For research use only |
NCBI | NP_001446 |
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-FOXO3 Antibody, Catalog Number: orb576501, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-FOXO3 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |