Cart summary

You have no items in your shopping cart.

FOS Rabbit Polyclonal Antibody

SKU: orb592712

Description

Rabbit polyclonal antibody to FOS

Research Area

Epigenetics & Chromatin, Immunology & Inflammation

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Mouse, Porcine, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FOS
TargetFOS
Protein SequenceSynthetic peptide located within the following region: MFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCT
Molecular Weight41kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

p55, AP-1, C-FOS

Similar Products

  • Phospho-SRF (Ser77) Rabbit Polyclonal Antibody [orb1497]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • C-fos Rabbit Polyclonal Antibody [orb10375]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • C-fos Rabbit Polyclonal Antibody [orb156348]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • Phospho-c-Fos (Thr325) Rabbit Polyclonal Antibody [orb5857]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Gallus, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • c-Fos Polyclonal Antibody [orb1414294]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FOS Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation and phosphorylation.

FOS Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

FOS Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.

FOS Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.

FOS Rabbit Polyclonal Antibody

Rabbit Anti-FOS Antibody, Catalog Number: orb592712, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Nucleus in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

FOS Rabbit Polyclonal Antibody

WB Suggested Anti-FOS Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005243

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

FOS Rabbit Polyclonal Antibody (orb592712)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry