FGB Rabbit Polyclonal Antibody

SKU: orb578383

Description

Rabbit polyclonal antibody to Fibrinogen

Research Area

Epigenetics, Immunology

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human FGB
Target	FGB
Protein Sequence	GNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNK
Molecular Weight	29kDa
Purity	Affinity Purified
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Buffer/Preservatives	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

HEL-S-78p

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

FGB

UniProt

P02675

RefSeq (Protein):NP_001171670.1

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001171670.1

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols