FCGR3A Rabbit Polyclonal Antibody

• Catalog Number: orb585692
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FCGR3A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: DPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYF
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 27kDa
• Target: FCGR3A
• UniProt ID: P08637
• Protein Sequence: Synthetic peptide located within the following region: DPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYF
• NCBI: NP_001121068
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CD16, FCG3, CD16A, FCGR3, IGFR3, IMD20, FCR-10, FC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Mouse Spleen (M-SP), Negative control (-): Mouse Intestine (M-IN), Antibody concentration: 1 ug/ml.

WB Suggested Anti-FCGR3A Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.