You have no items in your shopping cart.
Cart summary
Item 1 of 1
FAM117B Rabbit Polyclonal Antibody
Catalog Number: orb326983
| Catalog Number | orb326983 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FAM117B |
| Target | FAM117B |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM117B |
| Protein Sequence | Synthetic peptide located within the following region: KGSGHSLTVTTGMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLP |
| UniProt ID | Q6P1L5 |
| MW | 64kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FAM117B antibody, anti ALS2CR13 antibody, ant Read more... |
| Note | For research use only |
| NCBI | NP_775782 |
Sample Type: U937 Whole cell lysates, Antibody Dilution: 1.0 ug/mL.
- Item 1 of 3
- Item 1 of 1
Anti-ALS2CR13 Antibody [orb393051]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
