Esp1 Antibody

SKU: orb334971

Description

Goat polyclonal antibody to Esp1. Exocrine gland secreted peptide 1 is a male-specific pheromone secreted by the extraorbital lacrimal gland into tears, which is recognized by the Vmn2r116/V2rp5 receptor.

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:2,000
• Reactivity: Mouse
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified full recombinant protein produced in E. coli. Antigen Sequence: MEMADQKTNHEADLKNPDPQEVQRALARILCALGELDKLVKDQANAGQQEFKLPKDFTGRSKCRSLGLE
• Target: Esp1
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (4 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: Please inquire
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Exocrine gland-secreted peptide 1 antibody.

Western blot analysis of staining of His-Esp1 cells lysate using Esp1 antibody

Quick Database Links

Gene Symbol

Esp1