Equine CCL5 protein

• Catalog Number: orb1216349
• Category: Proteins
• Description: The Equine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS) (Gene ID: 100033925).
• Target: CCL5
• Form/Appearance: Lyophilized
• Purity: 98%
• Protein Sequence: SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS
• Protein Length: 68
• MW: 7.9 kDa
• Source: Yeast
• Biological Origin: Equine
• Storage: -20°C
• Alternative names: RANTES
• Note: For research use only