You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb576233 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RANTES |
| Target | CCL5 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CCL5 |
| Protein Sequence | Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
| UniProt ID | P30882 |
| MW | 10kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | S, RA, Scy, MuRa, SISd, Scya5, TCP22, RANTES, TCP2 Read more... |
| Research Area | Epigenetics & Chromatin, Immunology & Inflammation Read more... |
| Note | For research use only |
| NCBI | NP_038681 |

WB Suggested Anti-CCL5 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: NIH/3T3 cell lysate.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Human, Mouse, Porcine | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Equine, Human, Mouse, Porcine | |
Rat | |
Rabbit | |
Polyclonal | |
FITC |
IF | |
Bovine, Canine, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review