CCL5 Rabbit Polyclonal Antibody

SKU: orb576233

Description

CCL5 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of CCL5. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of mouse CCL5. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse CCL5
• Target: CCL5
• Protein Sequence: Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN
• Molecular Weight: 10kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

S, RA, Scy, MuRa, SISd, Scya5, TCP22, RANTES, TCP228, MuRantes

WB Suggested Anti-CCL5 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: NIH/3T3 cell lysate.

Quick Database Links

Gene Symbol

CCL5

UniProt

P30882

RefSeq (Protein):NP_038681