CCL5 Rabbit Polyclonal Antibody

• Catalog Number: orb576233
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RANTES
• Target: CCL5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse CCL5
• Protein Sequence: Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN
• UniProt ID: P30882
• MW: 10kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: S, RA, Scy, MuRa, SISd, Scya5, TCP22, RANTES, TCP2
• Research Area: Epigenetics & Chromatin, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_038681

WB Suggested Anti-CCL5 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: NIH/3T3 cell lysate.