ELMO2 Rabbit Polyclonal Antibody

• Catalog Number: orb589054
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ELMO2
• Target: ELMO2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ELMO2
• Protein Sequence: Synthetic peptide located within the following region: RIAFDAESDPSNAPGSGTEKRKAMYTKDYKMLGFTNHINPAMDFTQTPPG
• UniProt ID: Q96JJ3
• MW: 83 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: VMPI, CED12, CED-12, ELMO-2, Ced-12A
• Research Area: Apoptotic, Cancer, Epigenetics, Neuroscience, Sign
• Note: For research use only
• NCBI: NP_573403.1

Sample Tissue: Human Liver Tumor, Antibody Dilution: 1.0 ug/ml.