EEF1A1 Rabbit Polyclonal Antibody

• Catalog Number: orb580310
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EEF1A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EEF1A1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: EEF1A1
• UniProt ID: P68104
• Protein Sequence: Synthetic peptide located within the following region: IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK
• NCBI: NP_001393
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CCS3, EF1A, PTI1, CCS-3, EE1A1, EEF-1, EEF1A, EF-T
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

WB Suggested Anti-EEF1A1 antibody Titration: 1 ug/ml, Sample Type: Human Hela.

WB Suggested Anti-EEF1A1 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.

WB Suggested Anti-EEF1A1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. EEF1A1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.