DNAH9 Rabbit Polyclonal Antibody

SKU: orb586345

Description

Rabbit polyclonal antibody to DNAH9

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNAH9
• Target: DNAH9
• Protein Sequence: Synthetic peptide located within the following region: DSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKVEERTPYIVVA
• Molecular Weight: 91kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DYH9, HL20, DNEL1, HL-20, CILD40, Dnahc9, DNAH17L

Sample Type: mouse tracheal epithelial cells, Primary Antibody dilution: 1:50, Secondary Antibody: Anti-rabbit alexa 488, Secondary Antibody dilution: 1:1000, Gene Name: DNAH9.

Sample Type: mouse tracheal epithelial cells, Primary Antibody dilution: 1:50, Secondary Antibody: Anti-rabbit alexa 488, Secondary Antibody dilution: 1:1000, Gene Name: DNAH9.

WB Suggested Anti-DNAH9 Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.

Quick Database Links

Gene Symbol

DNAH9

UniProt

A2VCQ8

RefSeq (Protein):NP_004653