Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

DNAH9 Rabbit Polyclonal Antibody

SKU: orb586345

Description

DNAH9 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of DNAH9. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNAH9. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human DNAH9
TargetDNAH9
Protein SequenceSynthetic peptide located within the following region: DSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKVEERTPYIVVA
Molecular Weight91kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DYH9, HL20, DNEL1, HL-20, CILD40, Dnahc9, DNAH17L

Similar Products

  • DNAH9 Rabbit Polyclonal Antibody (Cy7) [orb1013680]

    ICC,  IF

    Canine, Equine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Cy7

    100 μl
  • DNAH9 Rabbit Polyclonal Antibody (Cy5.5) [orb1013710]

    ICC,  IF

    Canine, Equine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Cy5.5

    100 μl
  • DNAH9 Rabbit Polyclonal Antibody (RBITC) [orb1014034]

    ICC,  IF

    Canine, Equine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    RBITC

    100 μl
  • DNAH9 Rabbit Polyclonal Antibody (PE) [orb498453]

    ICC,  IF

    Canine, Equine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    PE

    100 μl
  • DNAH9 Rabbit Polyclonal Antibody (APC) [orb992066]

    ICC,  IF

    Canine, Equine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    APC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

DNAH9 Rabbit Polyclonal Antibody

Sample Type: mouse tracheal epithelial cells, Primary Antibody dilution: 1:50, Secondary Antibody: Anti-rabbit alexa 488, Secondary Antibody dilution: 1:1000, Gene Name: DNAH9.

DNAH9 Rabbit Polyclonal Antibody

Sample Type: mouse tracheal epithelial cells, Primary Antibody dilution: 1:50, Secondary Antibody: Anti-rabbit alexa 488, Secondary Antibody dilution: 1:1000, Gene Name: DNAH9.

DNAH9 Rabbit Polyclonal Antibody

WB Suggested Anti-DNAH9 Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004653

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

DNAH9 Rabbit Polyclonal Antibody (orb586345)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry