You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CLPTM1L |
| Target | CLPTM1L |
| Protein Sequence | Synthetic peptide located within the following region: KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD |
| Molecular Weight | 62 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CRR9 Rabbit Polyclonal Antibody [orb101360]
ELISA, ICC, IF, IHC-Fr, IHC-P
Canine, Equine, Human, Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlCLPTM1L Rabbit Polyclonal Antibody [orb1880340]
WB
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μlCLPTM1L Antibody [orb1283837]
IHC, WB
Human
Rabbit
Polyclonal
Unconjugated

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~40 kDa.

Rabbit Anti-CLPTM1L antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-CLPTM1L antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-CLPTM1L Antibody, Catalog Number: orb580932, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CLPTM1L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: ACHN cell lysate.
Documents Download
Request a Document
Protocol Information
CLPTM1L Rabbit Polyclonal Antibody (orb580932)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


