CHI3L1 Rabbit Polyclonal Antibody

SKU: orb581500

Description

CHI3L1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CHI3L1. It is suitable for IF, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1. This antibody reacts with Human, Monkey samples and is predicted to react with Bovine, Canine, Goat, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: IF, WB
• Reactivity: Human, Monkey
• Predicted Reactivity: Bovine, Canine, Goat, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1
• Target: CHI3L1
• Protein Sequence: Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
• Molecular Weight: 43 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GP39, ASRT7, GP-39, YK-40, YKL40, CGP-39, YKL-40, YYL-40, HC-gp39, HCGP-3P, hCGP-39

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

simian immunodeficiency virus encephalitis.

WB Suggested Anti-CHI3L1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

CHI3L1

UniProt

P36222

RefSeq (Protein):NP_001267