CHI3L1 Rabbit Polyclonal Antibody

• Catalog Number: orb581500
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHI3L1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Bovine, Canine, Goat, Porcine, Rabbit, Rat
• Reactivity: Human, Monkey
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43 kDa
• Target: CHI3L1
• UniProt ID: P36222
• Protein Sequence: Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
• NCBI: NP_001267
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GP39, ASRT7, GP-39, YK-40, YKL40, CGP-39, YKL-40,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

simian immunodeficiency virus encephalitis.

WB Suggested Anti-CHI3L1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.