You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579637 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CENPA |
Target | CENPA |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CENPA |
Protein Sequence | Synthetic peptide located within the following region: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE |
UniProt ID | P49450 |
MW | 16kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CenH3, CENP-A |
Research Area | Cell Biology, Immunology & Inflammation, Signal Tr Read more... |
Note | For research use only |
NCBI | NP_001800 |
Expiration Date | 12 months from date of receipt. |
Human Skin
WB Suggested Anti-CENPA Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate. CENPA is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
ELISA, FC, IF, IHC-Fr, IHC-P | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |