Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CENPA Rabbit Polyclonal Antibody

SKU: orb579638

Description

CENPA Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CENPA. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human CENPA. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CENPA
TargetCENPA
Protein SequenceSynthetic peptide located within the following region: ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
Molecular Weight16kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CenH3, CENP-A

Similar Products

  • CENPA Rabbit Polyclonal Antibody [orb5846]

    ELISA,  IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CENP-A (phospho Ser7) rabbit pAb Antibody [orb767385]

    ELISA,  IF

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CENP-A rabbit pAb Antibody [orb767387]

    ELISA,  IF,  IHC

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CENPA (Phospho-S7) Rabbit Polyclonal Antibody [orb1289873]

    IF,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 30 μl, 100 μl, 50 μl
  • CENPA Rabbit Polyclonal Antibody [orb235090]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CENPA Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. CENPA is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

CENPA Rabbit Polyclonal Antibody

WB Suggested Anti-CENPA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate. CENPA is strongly supported by BioGPS gene expression data to be expressed in HeLa.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001800

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CENPA Rabbit Polyclonal Antibody (orb579638)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchPlease enquire for availability.
Bulk Enquiry