You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324847 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CELF2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CELF2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55 kDa |
Target | CELF2 |
UniProt ID | O95319 |
Protein Sequence | Synthetic peptide located within the following region: AALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCN |
NCBI | NP_001313248 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti BRUNOL3 antibody, anti ETR-3 antibody, anti N Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Heart tissue using CELF2 antibody
Western blot analysis of human Jurkat tissue using CELF2 antibody
Western blot analysis of human 721_B tissue using CELF2 antibody
Western blot analysis of human Placenta tissue using CELF2 antibody
Western blot analysis of human Fetal Lung tissue using CELF2 antibody
Western blot analysis of human Fetal Liver tissue using CELF2 antibody
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Bovine, Porcine, Rabbit, Xenopus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating