CELF2 Rabbit Polyclonal Antibody

• Catalog Number: orb324847
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CELF2
• Target: CELF2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CELF2
• Protein Sequence: Synthetic peptide located within the following region: AALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCN
• UniProt ID: O95319
• MW: 55 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti BRUNOL3 antibody, anti ETR-3 antibody, anti N
• Note: For research use only
• NCBI: NP_001313248

Sample Tissue: Human U937 Whole Cell lysates, Antibody Dilution: 1 ug/mL.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, CELF2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, CELF2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.