CELF2 antibody

• Catalog Number: orb324846
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CELF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CUGBP2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: CELF2
• UniProt ID: Q96RQ6
• Protein Sequence: Synthetic peptide located within the following region: VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP
• NCBI: NP_006552
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ETR3 antibody, anti ETR-3 antibody, anti NAPO
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Lung tissue using CELF2 antibody

Western blot analysis of Jurkat cell lysate tissue using CELF2 antibody

Immunohistochemical staining of human Heart tissue using CELF2 antibody