Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CDKN1A Rabbit Polyclonal Antibody

SKU: orb573599

Description

CDKN1A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CDKN1A. It is suitable for IHC application. The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDKN1A. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsIHC
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human CDKN1A
TargetCDKN1A
Protein SequenceSynthetic peptide located within the following region: KACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAW
Molecular Weight18kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

P21, CIP1, SDI1, WAF1, CAP20, CDKN1, MDA-6, p21CIP1

Similar Products

  • Phospho-CDKN1A/p21 (Thr145) Rabbit Polyclonal Antibody [orb6568]

    FC,  IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-CDKN1A/p21 (Ser130) Rabbit Polyclonal Antibody [orb6571]

    FC,  IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CDKN1A/p21 Rabbit Polyclonal Antibody [orb11203]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Gallus

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-PAK6 (Ser560) Rabbit Polyclonal Antibody [orb6634]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Phospho-CDKN1A/p21 (Thr57) Rabbit Polyclonal Antibody [orb6569]

    FC,  IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CDKN1A Rabbit Polyclonal Antibody

Sample Type: Human Diseased Prostate. Primary Antibody dilution: 20 ug/ml. Color/Signal Descriptions: CDKN1A (DAB; brown), nuclei (hematoxylin; blue). Gene Name: CDKN1A.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_510867

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

IHC
Immunohistochemistry
View Protocol

CDKN1A Rabbit Polyclonal Antibody (orb573599)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry