CDH2 Antibody

SKU: orb11619

Description

Goat polyclonal to CDH2. CDH2 is a classical member of the cadherin superfamily. This protein is a calcium dependent cell-cell adhesion glycoprotein comprised consists of 5 cadherin repeats in the extracellular domain, one trans membrane domain, and a highly conserved intracellular domain. It has been shown to play an essential role in normal neuronal development, which is implicated in an array of processes including neuronal differentiation, migration, axon growth and fasciculation.

Images & Validation

• Tested Applications: IF, WB
• Dilution Range: WB:1:500-1:2,000, IF:1:25-1:250
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 850 aa to C-terminus of human CDH2 produced in E. coli. Antigen Sequence: VFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
• Target: N-Cadherin
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: Please inquire
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

cadherin 2, cadherin-2, CD325, CDHN, CDw325, CDH2, NCAD, N-cadherin, N-cadherin 1, neural cadherin, neural-cadherin, neural cadherin (NCAD) antibody.

Western blot analysis of COS-7 cell lysate using N-Cadherin antibody

Quick Database Links

Gene Symbol

N-Cadherin