CDH1 Antibody

SKU: orb11613

Description

Goat polyclonal to CDH1. CDH1 is a classical member of the cadherin superfamily. This protein is a calcium dependent cell-cell adhesion glycoprotein comprised consists of 5 cadherin repeats in the extracellular domain, one trans membrane domain, and a and a highly conserved intracellular domain that binds b-catenin and p120-catenin. CDH1 is involved in mechanisms regulating proliferation, mobility and cell-cell adhesions of epithelial cells. Loss of E-cadherin function or expression has been implicated in cancer metastasis and progression.

Images & Validation

• Tested Applications: IF, IHC-Fr, IHC-P, WB
• Dilution Range: WB:1:500-1:2,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Reactivity: Human, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 750 to 850 of human CDH1 produced in E. coli. Antigen Sequence: YYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSL
• Target: E-Cadherin
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: Please inquire
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ARC-1, CAM 120/80, CD324, CDH1, cdhc-A, CDHE, ECAD, E-Cad E-cadherin, Epithelial cadherin, l-cam, LCAM, P09803, P12830 / Q9R0T4, UVO, Uvomorulin, XBcad, XB-cadherin, XTCAD-1 antibody.

Western blot analysis of AtT-20 cell lysate using E-Cadherin antibody

Quick Database Links

Gene Symbol

E-Cadherin