CD9 Antibody

SKU: orb1945893

Description

CD9 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. This protein functions in many cellular processes including differentiation, adhesion, and signal transduction, playing a critical role in the suppression of cancer cell motility and metastasis.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:1,000-1:2,000
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 115 aa to 195 aa of human CD9 produced in E. coli. Antigen Sequence: HKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKF
• Target: CD9
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

5H9 Antigen, BA2, BA-2/P24 Antigen 3, BTCC-1, Cell Growth-Inhibiting Gene 2 Protein, CD9 antigen, CD9 Molecule, DRAP-27, Leukocyte Antigen MIC3, MIC3, Motility Related Protein-1, Motility-Related Protein 4, MRP-1, P24, Tetraspanin-29, TSPAN29 antibody.

Quick Database Links

Gene Symbol

CD9