CCKBR Rabbit Polyclonal Antibody

• Catalog Number: orb589625
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCKBR
• Target: CCKBR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCKBR
• Protein Sequence: Synthetic peptide located within the following region: PLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRL
• UniProt ID: P32239
• MW: 49 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GASR, CCK-B, CCK2R
• Note: For research use only
• NCBI: NP_795344.1

Sample Tissue: Human MCF7 Whole Cell lysates, Antibody Dilution: 1 ug/ml.