You have no items in your shopping cart.
Description
Research Area
Cardiovascular Research
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Dilution Range | WB:1:1,000-1:5,000 |
| Reactivity | Human |
| Application Notes |
Key Properties
−| Host | Goat |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 389 aa to the C-terminus of human CCBE1 produced in E. coli. Antigen Sequence: SCRKRCSGTGLTLQQRSSLYLRNFPATQKPWTWALEMTIQEELRQET |
| Target | collagen and calcium binding EGF domains 1 antibody |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. |
| Concentration | Please inquire |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−collagen and calcium binding EGF domains 1 antibody
Similar Products
−CCBE1 rabbit pAb Antibody [orb773551]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μlCCBE1 Rabbit Polyclonal Antibody [orb581754]
WB
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μlCCBE1 Rabbit Polyclonal Antibody [orb215381]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 30 μl, 100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
collagen and calcium binding EGF domains 1 antibody
Documents Download
Datasheet
Product Information
Request a Document
CCBE1 Antibody (orb1945895)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



