CCBE1 Antibody

SKU: orb1945895

Description

Goat polyclonal antibody to CCBE1. CCBE1 is thought to function in extracellular matrix remodeling and migration. It is required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis.

Images & Validation

• Tested Applications: WB
• Dilution range: WB:1:1,000-1:5,000
• Reactivity: Human
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 389 aa to the C-terminus of human CCBE1 produced in E. coli.. Antigen Sequence: SCRKRCSGTGLTLQQRSSLYLRNFPATQKPWTWALEMTIQEELRQET
• Target: collagen and calcium binding EGF domains 1 antibody
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 3 mg/ml
• Disclaimer: For research use only

Alternative Names

collagen and calcium binding EGF domains 1 antibody

Quick Database Links

Gene Symbol

collagen and calcium binding EGF domains 1 antibody