Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CAMK4 Rabbit Polyclonal Antibody

SKU: orb576184

Description

CAMK4 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of CAMK4. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of mouse CAMK4. This antibody reacts with Human samples and is predicted to react with Mouse. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityMouse

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of mouse CAMK4
TargetCAMK4
Protein SequenceSynthetic peptide located within the following region: VKAVVASSRLGSASSSHTSIQENHKASSDPPSTQDAKDSTDLLGKKMQEE
Molecular Weight52kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CaM, CaMKI, CaMKIV, AI666733, CaMKIV/Gr, D18Bwg0362e, A430110E23Rik

Similar Products

  • CAMKIV/Camk4 Rabbit Polyclonal Antibody [orb763026]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CaMKIV (phospho Thr200) rabbit pAb Antibody [orb770510]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CaMKIV rabbit pAb Antibody [orb770511]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CaMK4 Rabbit Polyclonal Antibody [orb318920]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • CaMK4 (Phospho-T200) Rabbit Polyclonal Antibody [orb393230]

    IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_033923

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry