Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

BRD9 Rabbit Polyclonal Antibody

SKU: orb575272

Description

Rabbit polyclonal antibody to BRD9

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human BRD9
TargetBRD9
Protein SequenceSynthetic peptide located within the following region: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE
Molecular Weight53kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PRO9856, LAVS3040

Similar Products

  • BRD9 Antibody (N-term) [orb1933008]

    IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • BRD9 Rabbit Polyclonal Antibody [orb577879]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • BRD9 Rabbit Polyclonal Antibody [orb625178]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • BRD9 Rabbit Polyclonal Antibody [orb1152368]

    ELISA,  FC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • BRD9 Rabbit Polyclonal Antibody [orb1880025]

    IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

BRD9 Rabbit Polyclonal Antibody

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Kidney (KI), Antibody concentration: 2.5 ug/ml.

BRD9 Rabbit Polyclonal Antibody

Lanes: 1: 60 ug mouse melanocytes (melba), 2: 60 ug mouse melanoma (B16), 3: 60 ug human melanocytes (HFSC), 4: 60 ug human melanoma (SK-MEL5), 5: 60 ug human melanoma (YUMAC), 6: 60 ug rat shwann cell, Primary Antibody dilution: 1:200, Secondary Antibody: Donkey anti-rabbit HPRT, Secondary Antibody dilution: 1:2000, Gene Name: BRD9.

BRD9 Rabbit Polyclonal Antibody

WB Suggested Anti-BRD9 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, BRD9 is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

BRD9 Rabbit Polyclonal Antibody (orb575272)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry