BRAT1 Rabbit Polyclonal Antibody

• Catalog Number: orb589430
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BRAT1
• Target: BRAT1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BAAT1
• Protein Sequence: Synthetic peptide located within the following region: IASYSSLREARGSPNTASAEATLPRWRAGEQAQPPGDQEPEAVLAMLRSL
• UniProt ID: Q6PJG6
• MW: 90 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BAAT1, RMFSL, NEDCAS, C7orf27
• Research Area: Cancer Biology, Cell Biology, Molecular Biology, S
• Note: For research use only
• NCBI: NP_689956.2

Sample Tissue: Human A172 Whole Cell lysates, Antibody Dilution: 1 ug/ml.