You have no items in your shopping cart.
Cart summary
Bovine VEGF-A protein
Catalog Number: orb1215728
| Catalog Number | orb1215728 |
|---|---|
| Category | Proteins |
| Description | The Bovine VEGF-A Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A Biotinylated applications are for cell culture. Bovine VEGF-A Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Biotinylated Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 19.2 kDa |
| Target | VEGF-A |
| Entrez | 281572 |
| Protein Sequence | APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Protein Length | 164 |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 3
Human VEGF121 Protein [orb257918]
Unconjugated
95%
14.1 kDa
Human VEGF121 Protein, premium grade (orb257918) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 147 (Accession # P15692-9).
1 mg, 50 μg, 20 μg - Item 1 of 3
Human VEGF121 Protein [orb334936]
Unconjugated
95%
14.9 kDa
Human VEGF121, His Tag (orb334936) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 147 (Accession # P15692-9).
1 mg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars